PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v2825520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 217aa    MW: 24878.5 Da    PI: 6.3045
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v2825520.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB181.76e-5736131297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      +eqdrflPianv+rimkkv+Pan+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGf+dyveplk+yl kyre+eg
  Lj4g3v2825520.1  36 KEQDRFLPIANVGRIMKKVIPANGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFDDYVEPLKTYLVKYREIEG 129
                      89*******************************************************************************************9 PP

            NF-YB  96 ek 97 
                      ek
  Lj4g3v2825520.1 130 EK 131
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-5430158IPR009072Histone-fold
SuperFamilySSF471133.11E-4138155IPR009072Histone-fold
PfamPF008089.9E-2841105IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-196987No hitNo description
PROSITE patternPS0068507288IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-1988106No hitNo description
PRINTSPR006151.2E-19107125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MEDESHNNNT LPNNGFSSGS PESPCLKPNN NNHHNKEQDR FLPIANVGRI MKKVIPANGK  60
ISKDAKETVQ ECVSEFISFV TGEASDKCQR EKRKTINGDD IIWAITTLGF DDYVEPLKTY  120
LVKYREIEGE KVNTPKQQQQ QRSDQQRLLQ HQHSQDENNI NNQPFNCVYT TSTNLMSHHQ  180
PPFVAADQPF PLPFSTNSIQ KQLRPQDQID SVGHWYE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B6e-4536126494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-4536126494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524310.11e-105PREDICTED: nuclear transcription factor Y subunit B-7-like
SwissprotQ9SIT92e-75NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLA0A0B2RPC71e-105A0A0B2RPC7_GLYSO; Nuclear transcription factor Y subunit B-7
TrEMBLI1K5111e-105I1K511_SOYBN; Uncharacterized protein
STRINGGLYMA05G32680.11e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132492430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.19e-74nuclear factor Y, subunit B7